PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g067280.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 295aa    MW: 32071.7 Da    PI: 6.6524
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g067280.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.14.5e-341670155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        k+rlrWt+eLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Sopim11g067280.0.1 16 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 70
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3371373IPR017930Myb domain
SuperFamilySSF466893.4E-181570IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-321571IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-261671IPR006447Myb domain, plants
PfamPF002491.2E-91869IPR001005SANT/Myb domain
PfamPF143792.5E-22102148IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDPSCGGNNS SSLASKQRLR WTNELHERFV DAVAQLGGPD RATPKGVLRV MGVQGLTIYH  60
VKSHLQKYRL AKYLPDSSSD GKNSDKKEPR DMLSSLDGSS GVEITTALKL QMEVQKRLHE  120
QLEVQKQLQL RIEAQGKYLK KIIEEQQRLS GVLSDVPGSG VTALPTGDNG PESDSRTDPG  180
TPAPSSEAPH VDKPVNAHTS TKSLSMDESF SSHHSPLSPD SDCQETSLME SPNGESSSKK  240
QRVGNVALPH QILESSVSPP YQQPHSVFMM RDQFNHTSGL SLDIEDHKVS GSNI*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001307345.10.0MYB-CC type transfactor
RefseqXP_010313350.10.0PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ8GUN56e-52PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLK4D9Y50.0K4D9Y5_SOLLC; Uncharacterized protein
STRINGSolyc11g067280.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27962451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-96G2-like family protein